PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRF
Protein Properties Length: 601aa    MW: 64774.8 Da    PI: 6.7946
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029905.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.5e-24222266145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Pbr029905.1 222 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 266
                  79****************************************985 PP

2QLQ58.32.3e-20156192137
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  ++FT++Q+ +L++Q+l+yKy+ +n+PvP++Ll +++k
  Pbr029905.1 156 GPFTPSQWIELEHQALIYKYMTSNVPVPSNLLIPLKK 192
                  59*******************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-11156192IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.429157192IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.3E-14157190IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.287222266IPR014977WRC domain
PfamPF088797.7E-21223265IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MAEVSRMDFG LMGLEGLVGP DAGGGEAAGK VGDGSGSAST KQQRSWPAED DWTTSKMPKN  60
EDLNAPKTMP LQYQGTPLLR SNSQLLPPPA ETLRQEQMLS FSNNKSEVSF LSKDGDFAYY  120
QRNPSAILSP YPRNAGSPGY GSLNLSMHGP LTGARGPFTP SQWIELEHQA LIYKYMTSNV  180
PVPSNLLIPL KKPLYTYGLS GPSNPTSIAW GAYHLGFSGN NDPEPGRCRR TDGKKWRCSR  240
DAVADQKYCE RHINRGRHRS RKPVEGQPGQ AVSGTSNSKR VPMNSSMSTS VMASNGASNS  300
VTTMPQQFKS LQPAVAANPS SVDAFVNRMQ DPRGLSVMSA PSLKPKSNNS TSKIGKQEFL  360
AEESSQSEFG IVSTDSLLNP SHRNSYISKD FGGSFLDFTD QESQDQHPLR QFMDDWPKDQ  420
SSHSVSTWPE EIKSDWTQLS MSIPMASSEF SSSSSSPTHE KLVLSPLRLS REFVPTQMNL  480
GMSNDLSESS QEQTNWIPIP WGNSMGGPLG EVITNTTSSG KICNNSTSPL NLLNDGWDGN  540
SQLGSSPTGV LQKSTFCSLS NSSSGSSPRG GEIKKSSLDG ASIYDDVLGS TFASSSVPSL  600
*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0561591e-65EU056159.1 Eriobotrya japonica clone ssrEJ102 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339165.10.0PREDICTED: growth-regulating factor 1-like isoform X1
TrEMBLD9ZIZ80.0D9ZIZ8_MALDO; GRF domain class transcription factor
STRINGVIT_00s0494g00010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-105growth-regulating factor 1